PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010934316.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 246aa    MW: 27985.3 Da    PI: 6.6784
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010934316.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1683.3e-52101381129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF P+deelv++yL kkv+++++++  ++ evd++++ePw+Lp  +k + +ewyfFs rd+kyatg+r+nratk+gyWkatgkd+++++ 
  XP_010934316.1  10 LPPGFRFYPSDEELVCHYLYKKVSNERISE-GTLVEVDLHTHEPWELPDVAKLSANEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDRTIHDP 103
                     79*************************999.88***************87788999**************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      +++ vg++ktLvfy+grap+g+k+ Wvmhe+rle
  XP_010934316.1 104 sSRAIVGMRKTLVFYQGRAPNGVKSGWVMHEFRLE 138
                     66677***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-608156IPR003441NAC domain
PROSITE profilePS5100558.43210156IPR003441NAC domain
PfamPF023654.6E-2811137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGLRDIESTL PPGFRFYPSD EELVCHYLYK KVSNERISEG TLVEVDLHTH EPWELPDVAK  60
LSANEWYFFS FRDRKYATGS RTNRATKTGY WKATGKDRTI HDPSSRAIVG MRKTLVFYQG  120
RAPNGVKSGW VMHEFRLETP KSTPKESWVL CRVFHKRKGE TEQDNIGSFS PTWGPSSSQV  180
DQTSSSLPAV PHQHDSSSNP LLNLALLHCN LLDFPQEVGM SSRGGDEYGF LLDMGLEDHD  240
MREGGW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-5111577169NAC domain-containing protein 19
3swp_C5e-5111577169NAC domain-containing protein 19
3swp_B5e-5111577169NAC domain-containing protein 19
3swp_A5e-5111577169NAC domain-containing protein 19
3swm_D5e-5111577169NAC domain-containing protein 19
3swm_C5e-5111577169NAC domain-containing protein 19
3swm_B5e-5111577169NAC domain-containing protein 19
3swm_A5e-5111577169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934316.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE68e-63NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLM0SZP61e-128M0SZP6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P18670_0011e-127(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69738166
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.11e-80NAC domain containing protein 74